NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114966_10001454

Scaffold Ga0114966_10001454


Overview

Basic Information
Taxon OID3300009161 Open in IMG/M
Scaffold IDGa0114966_10001454 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21897
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (64.29%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F006841Metagenome / Metatranscriptome363Y

Sequences

Protein IDFamilyRBSSequence
Ga0114966_1000145424F000258GAGGMANYKLDAMFEIRKFLWSRLTALDIFEENDYYSDNLGEALIPIVPVQQQPEMNQFLSGKKHIVYDKIGMSYEDNWMICCEQILLTLYSPDLLDIVEIRNFLTDEFRRMDESAKDVNKWAGLSNKFKFHSIHIADISSTAPSEEIHGFFASDVILEIKYSRITNGAGRFL*
Ga0114966_1000145426F006841AGGAGGLATTVYDVEEIELQSGAKVKLKPLSIKQLRKFMIVIKKVQDAEDETATLGILVEACGVALETQLPDLVADLEKLEEALDVPTINRILEVCGGIKMDDPNLIAAAVLAGQI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.