NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114966_10236235

Scaffold Ga0114966_10236235


Overview

Basic Information
Taxon OID3300009161 Open in IMG/M
Scaffold IDGa0114966_10236235 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1136
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F002207Metagenome / Metatranscriptome583Y

Sequences

Protein IDFamilyRBSSequence
Ga0114966_102362351F002207GAGGMIKDRLNKPFTLAQETFGMGDISTMGFPTKIEQVSYSNPVFSFHNIHSYKDEGITDEEYACQPTRGDYDIQNDPDWFRKSVEFAKTQKDWYSWNTSNWGTKWDVAVRDGDK
Ga0114966_102362352F000450N/ATSTRKGGNVMGDRANFGFVQPNGSTIVLYGHWAGHNMLAQLAEAAIKAQGRWSDPSYATRITISHMIGEGWAMETGWGLHVNEIGDNEHKIPVIDFQQQTFSLHEEAPYADLSNKVRGMKNEAMFTQDLSNFCEKYSDQLVRV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.