NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114970_10187750

Scaffold Ga0114970_10187750


Overview

Basic Information
Taxon OID3300009163 Open in IMG/M
Scaffold IDGa0114970_10187750 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1223
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002413Metagenome / Metatranscriptome561Y
F025265Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0114970_101877501F025265N/AYGKALAMLVGKYSGKFTEEIRLDATAAEYLQYLEPACGQTILVGVEVEANGEYNGRPQFKYKMTYPKGSQKPTVADTLPDAPPF*
Ga0114970_101877502F002413N/AMAAPTLVLISGFARAGKDTLASGLLEWSNRPAEHINFADALKEAGNHFMDYLGLEGNFMAEDFKCENRDALVAMGRFARRLDKDVFARHFANWCPVMKHHDQVSPETVVCSDWRYINELRVCQDILWEKGWKVRTVYVSTAGVGPANDEELDSIAEIRASHSFDQEFIFKQNARQQIMSEGRILAKSWRL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.