NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114975_10003756

Scaffold Ga0114975_10003756


Overview

Basic Information
Taxon OID3300009164 Open in IMG/M
Scaffold IDGa0114975_10003756 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10045
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (73.91%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011151Metagenome / Metatranscriptome294Y
F014135Metagenome / Metatranscriptome265Y
F022413Metagenome / Metatranscriptome214N
F100405Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0114975_1000375615F100405AGGAMTKSVQQYTKIFEVLQAANAPVPVSTIRAIDGIVATRLSTYLWEIKKNTGFAVRSNRDGRTVVSYELVGAGTAPVAKPAKVKAVKTAKAPVVKAAKPVKAKKVTPTPVPAGDSLEGIMSAMAKSSAKKPVNLLDEIDTDVEDFEDRQFAEAYIRT*
Ga0114975_1000375619F014135GGAGMSARLSIDFDTADRITMLNLQDQLKYLRKELEDYKEGKWLHPEDVVNNAKIIEALELLIPYYGGTV*
Ga0114975_1000375622F022413AGGAMLLAKPKLTNTLDAKEFETFAECQEYLEAYTDISMPLVEWIALGKILVAETMTTPEFYPKKVKGQIVMAKFDIEEFA*
Ga0114975_1000375623F011151N/AFQSKRKMAEDRFKVYCEWCHDWHYTDEVEMLNIEEDIQGRDVMHFECGQPPSWNEDISRYDGTSSLVYKE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.