Scaffold Ga0105102_10793762

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105102_10793762

Scaffold Ga0105102_10793762

Overview

Basic Information
Taxon OID	3300009165 Open in IMG/M
Scaffold ID	Ga0105102_10793762 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	538
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Name	near Jamestown, North Dakota
Coordinates	Lat. (^o)	47.0956	Long. (^o)	-99.1001	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007571	Metagenome / Metatranscriptome	348	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105102_107937621	F007571	N/A	YGVMRFTPNRLMVAPSGGEDGIDFAGLLGAVADGRPLFAAAAPQNAAGLISQGSTNGTVAGLDLVVDPNYTGDNANVKHALVYPSAAMRFHESGTFDIRANIVANGRVEIGLYGYVCAVNRYPAAFRKLSVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.