Scaffold Ga0105241_10003174

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105241_10003174

Scaffold Ga0105241_10003174

Overview

Basic Information
Taxon OID	3300009174 Open in IMG/M
Scaffold ID	Ga0105241_10003174 Open in IMG/M
Source Dataset Name	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12231
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (41.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location Name	Michigan, USA
Coordinates	Lat. (^o)	42.3948	Long. (^o)	-85.3738	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081404	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105241_1000317410	F081404	AGG	VVASGLLCCALILVVLFTSPSAFRSPAAVVVMALIGTAAVLVQLRLRNGDQTRSVRPPLWLNILGILLSLAALFPAVFHLGLRFAQPLALGAVSSFALSSAIILHSLRKHSPKAE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.