Scaffold Ga0115028_10859959

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115028_10859959

Scaffold Ga0115028_10859959

Overview

Basic Information
Taxon OID	3300009179 Open in IMG/M
Scaffold ID	Ga0115028_10859959 Open in IMG/M
Source Dataset Name	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	713
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location
Location Name	Old Woman Creek National Estuarine Research Reserve, Ohio, USA
Coordinates	Lat. (^o)	41.224	Long. (^o)	-82.304	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067889	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115028_108599592	F067889	AGGAGG	VRRLIAAAAILAVVFVIGCQDTKKVSELQGQVDKLNQQIADLQSTVVVKLTAERDSLAKVLADLQAKYPAKGGTTKPPSGGGGNVKPPAKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.