NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114979_10177753

Scaffold Ga0114979_10177753


Overview

Basic Information
Taxon OID3300009180 Open in IMG/M
Scaffold IDGa0114979_10177753 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1296
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000441Metagenome / Metatranscriptome1136Y
F000852Metagenome / Metatranscriptome860Y
F007644Metagenome / Metatranscriptome347Y

Sequences

Protein IDFamilyRBSSequence
Ga0114979_101777531F007644N/AMKLHLLSLNQDLEMNPESINVIDIPGQIYATEHLLSVATDIMNETNERYINE*
Ga0114979_101777532F000263AGGMNNEDIGLPPHLQRMVNAGVSGLDIMHGELKNLMLIAEQELAEAIAVEEESEEAMDSMDRTRCEGALDTLVELYSLTYQLSFAIGARNEA*
Ga0114979_101777534F000441AGGAMSDEYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRVEQIN*
Ga0114979_101777535F000852AGGAMTTKREYLKAQGIHVGVRGRFSGAAKQILKEAEDKGLTFTKEVKTK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.