NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114969_10053135

Scaffold Ga0114969_10053135


Overview

Basic Information
Taxon OID3300009181 Open in IMG/M
Scaffold IDGa0114969_10053135 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2702
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F011394Metagenome / Metatranscriptome291Y
F014140Metagenome / Metatranscriptome265Y
F066776Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0114969_100531354F014140N/AMNKYRIKLDVEVEVEAFNSEDASEYIHDIFNIDDEIKKVNIVKITSK*
Ga0114969_100531356F066776GGAGVLNLTLKGVEVFIDRLQATKEEAFWNNYDLVIWKKDNSGYSDIKGIYRNDAWGKAEKISVNSEGIWKLPNKYVKHFK*
Ga0114969_100531358F011394N/AMFIDKNKDHFKYGVNEWTGEPNKPTFYNKEMALKIRELKKPSSDLKMDIVKYPEFLAIRLYEDNFARYDGSMKMRVIDYIEMVKKILESYGVRVELEGKPGDGK*
Ga0114969_100531359F000671GAGGMIDKVLCYSCSKSKNQLNVKKSSLISINLLLCETCISSKFEPRWVVILAGRQYGAELVKDVILKKRYLGKEISASELLV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.