Scaffold Ga0114974_10104075

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114974_10104075

Scaffold Ga0114974_10104075

Overview

Basic Information
Taxon OID	3300009183 Open in IMG/M
Scaffold ID	Ga0114974_10104075 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1823
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Simoncouche, Canada
Coordinates	Lat. (^o)	48.2311	Long. (^o)	-71.2508	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054872	Metagenome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114974_101040754	F054872	N/A	MKKLTLLMMVGLMSLAVYGQKIEIGAAVSNSGKYLGEINILDSAQSFSRRGDWTITKGLNPMIYTSPSYSSYYYYAPNNIDVPASNNYYLGTFVRLGKRSSNLFSTDLGFGIGAARIYEVISKYDPSTSTYIGTLIDNGVKPSIGMTFGINLQVMKRVSTHFKCGGLFNDNGGFAVVGFRYSLPIKNT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.