NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114983_1001504

Scaffold Ga0114983_1001504


Overview

Basic Information
Taxon OID3300009194 Open in IMG/M
Scaffold IDGa0114983_1001504 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9193
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.849Long. (o)-81.036Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031872Metagenome / Metatranscriptome181N
F033435Metagenome / Metatranscriptome177N
F097357Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0114983_10015043F031872GAGGMVESLVVDEWIYDTLTADATLQGLLAVDNRSPSYQQGIYLYLAPEKDPISLRQPQVPYIVVRHIDAGQTDTTSMCGGRIVTTSSHQVWCWDTQSGAVSMARIKAIVDRIDTLLNKQSVNSTTPVFFLNRASVSSSVDVSQDGRVDNGIAQIYVATITPEV*
Ga0114983_10015045F033435AGGALRSIFDNIPKLEGRPNLVVDIERFIGTPGSIVFREPKASDLFPRPEVEKMLKIAYPEFPAQMLQILMIMARCYVIQPGDGEINPGRRFAQLARDRSDIYLYVVAEFARAFPIDFAAAVDEVPND*
Ga0114983_10015046F097357N/AVRHLKRHPRETDFSLDEYAEVAWAAEVWDNQIVEIVKAVMSVMAKRTL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.