NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114983_1004851

Scaffold Ga0114983_1004851


Overview

Basic Information
Taxon OID3300009194 Open in IMG/M
Scaffold IDGa0114983_1004851 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4538
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.849Long. (o)-81.036Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000450Metagenome / Metatranscriptome1126Y
F001043Metagenome / Metatranscriptome794Y

Sequences

Protein IDFamilyRBSSequence
Ga0114983_10048512F000450AGGCGGMGDRANFGFVQPNGQTIVLYGHWAGHNMLGKLADAVIKARPRWSDSSYATRIATSHLVGNEWSSETGWGLYVNQIGDNEHKIAIVDFSQQTFSLHEEAPYVDQDNKVRGMNNNAIFTMDLSSFCEKYALEEILVV*
Ga0114983_10048514F001043AGGAGVSDYKDGFQDGYKFGREELMEKLREIDINDIDAWILDRISDMIEGGKL*
Ga0114983_10048515F000311AGGGGGMYFELTAPDRLSMEMAYWDAQMIGLDPQAMSPLTFNVGTGSIEKVSRIRDKHGLTESYVSDYEPTGYVRR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.