NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103743_1001161

Scaffold Ga0103743_1001161


Overview

Basic Information
Taxon OID3300009195 Open in IMG/M
Scaffold IDGa0103743_1001161 Open in IMG/M
Source Dataset NameEukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4C
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2270
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica

Source Dataset Sampling Location
Location NameIce edge, McMurdo Sound, Antarctica
CoordinatesLat. (o)-77.36Long. (o)164.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064368Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0103743_10011614F064368AGGMKIFKRIKISSDGSYHFFNSGETSLSNKLVIFEKQDDKNFTFNQKNKQIVIDSKQSSYYKKKY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.