NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114993_10777090

Scaffold Ga0114993_10777090


Overview

Basic Information
Taxon OID3300009409 Open in IMG/M
Scaffold IDGa0114993_10777090 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)693
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006364Metagenome / Metatranscriptome375Y
F007608Metagenome / Metatranscriptome348Y

Sequences

Protein IDFamilyRBSSequence
Ga0114993_107770903F006364AGGAGMELEIDNETRKMRIINYLDYMDDKSLQEIAAALYNLSKRRQEISNKKKLVDESGK*
Ga0114993_107770904F007608AGAAGMSQENKYEKLPNSMYPKVRQQVVDRIETFEKVIEEHETAQKEALKMVYDQLEEAQNDLKYLDEVNVN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.