NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114953_1147735

Scaffold Ga0114953_1147735


Overview

Basic Information
Taxon OID3300009417 Open in IMG/M
Scaffold IDGa0114953_1147735 Open in IMG/M
Source Dataset NameMarine algal microbial communities from Sidmouth, United Kingdom - Sidmouth_Male2 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location NameSidmouth, United Kingdom
CoordinatesLat. (o)50.677Long. (o)-3.24Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029971Metagenome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0114953_11477352F029971N/APSVGNPLGNRIVSFDPVEHRDIPDAAFDQLDHVPSDRVPQGLARVVACDPGELRGYTTGTLMAGLCHTVVSLGDSVAQWARNNAGIPPQQVEELLQLVGRRNARAVLLRETSVAAGGMSRREQHLRDRDVYHEEPPAQRPRGPPGHEGGAPLSGRR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.