Scaffold Ga0114908_1189326

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114908_1189326

Scaffold Ga0114908_1189326

Overview

Basic Information
Taxon OID	3300009418 Open in IMG/M
Scaffold ID	Ga0114908_1189326 Open in IMG/M
Source Dataset Name	Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	643
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Mediterranean Sea
Coordinates	Lat. (^o)	39.48	Long. (^o)	7.31	Alt. (m)		Depth (m)	2520
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015401	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114908_11893262	F015401	N/A	ENRMKTSEKNILNVMYNNHRILIDKITEYDYNGDMAVAKKMVTVIHYTDSGDATPMIFNVSPYTSLVDMHTMVRVWIDCGCPSDSDMFNVPRKWTKESLHEWVAG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.