Scaffold Ga0114997_10144551

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114997_10144551

Scaffold Ga0114997_10144551

Overview

Basic Information
Taxon OID	3300009425 Open in IMG/M
Scaffold ID	Ga0114997_10144551 Open in IMG/M
Source Dataset Name	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1411
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location Name	Arctic Ocean: Canada Basin
Coordinates	Lat. (^o)	75.235	Long. (^o)	-150.0691	Alt. (m)		Depth (m)	79
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036437	Metagenome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114997_101445515	F036437	AGGTGG	VKTLILILLSSQAEFTVSSKLDLIYLTLPQEINNCFQAVDDIRENIATYNKETNQWLLKDGSQFIGGMCE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.