NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114915_1001422

Scaffold Ga0114915_1001422


Overview

Basic Information
Taxon OID3300009428 Open in IMG/M
Scaffold IDGa0114915_1001422 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10354
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (7.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth Georgia Island
CoordinatesLat. (o)-50.35Long. (o)-39.82Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054359Metagenome / Metatranscriptome140Y
F098052Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0114915_100142213F098052N/AMSKNNKTNPQVYSGIFRFKYTELKNKTEIISELVIETKDVVRSIGRFGESRKLVKLDVKQLNNKNYE*
Ga0114915_10014222F054359N/AMELIYFILGFLFTVTGYGIVLLYKTQSSHKSLLDELYKSQDFFSKQFEVYNDRNSLLTSEIKQVSEEYNSIQKQLKTDAYEGNTKLNDRITVLSRLFNEQGNRNKQLFDLADKQLRQNQNEIQQCNNTLKKIVDDPTVLARY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.