NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115562_1009945

Scaffold Ga0115562_1009945


Overview

Basic Information
Taxon OID3300009434 Open in IMG/M
Scaffold IDGa0115562_1009945 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110516
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5517
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (7.69%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028771Metagenome / Metatranscriptome190N
F062669Metagenome / Metatranscriptome130N
F090234Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0115562_100994510F062669N/AMARKKLIKYYDTDNEAQSYSFKEGYVIYPEPMNVDSFKGEWRVSIELGHRKHTYPEILSLTEAYSKIWNEYKKIQNRDKNDKN*
Ga0115562_10099452F090234N/AMEVFDEELNKHYRSLDESSECMECGIEVQLGKRYCCFSCLDASNR*
Ga0115562_10099457F028771N/AMSFLKGNIGESLWLSEISKTHTDIEKAPNKKFYDWDVKAKYNGREVTYEVKYDAKGYYYADRYNRPVNIYIEFLNTKKGESSGILASKATYYVYILKSLDDVETAYVFDRLELLEYLRNADIKVKGNSFGGDNNAKGWIPPLNSLKHLILKKVLFI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.