 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009441 Open in IMG/M |
| Scaffold ID | Ga0115007_11070948 Open in IMG/M |
| Source Dataset Name | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 557 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 78.8669 | Long. (o) | -3.2286 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007773 | Metagenome | 345 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115007_110709482 | F007773 | GAG | VKQNNVINLSDYREEKETSQNPPQYIQDFEVGGYYIYPELGVMIHCMLITDSSHTHKNELMYIMEDQFGNIFSVPIDDPDSMMGWRFLEKEVFTEMVKKGLPEP |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |