NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114956_1210190

Scaffold Ga0114956_1210190


Overview

Basic Information
Taxon OID3300009446 Open in IMG/M
Scaffold IDGa0114956_1210190 Open in IMG/M
Source Dataset NameMarine algal microbial communities from Maine, USA - Maine_Asex2 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)832
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → Undibacterium baiyunense(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location NameMaine, USA
CoordinatesLat. (o)44.342Long. (o)-68.065Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086530Metagenome110N

Sequences

Protein IDFamilyRBSSequence
Ga0114956_12101901F086530N/AMAHALGRLRTDVSASFDRDKEWNGTPAFGVVEFLSRYVNAGDDNDVSEGRALYLLPEFTKGDLKRELYTSMPSLQRGRSGEVSSYLELTKWLLRKYTNEQSVCDQESSFHGAAQRADKTDNGYFVLFRGLHRLCSCILTAGQMRSRYMQGLGWQIRADVREHNTRYLPMDLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.