Scaffold Ga0114956_1387004

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114956_1387004

Scaffold Ga0114956_1387004

Overview

Basic Information
Taxon OID	3300009446 Open in IMG/M
Scaffold ID	Ga0114956_1387004 Open in IMG/M
Source Dataset Name	Marine algal microbial communities from Maine, USA - Maine_Asex2 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	555
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location Name	Maine, USA
Coordinates	Lat. (^o)	44.342	Long. (^o)	-68.065	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058639	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114956_13870041	F058639	N/A	IAVSLANRAATVYWAVTAVPRKSVDTTCIQKPKVRLARILAAARPGRLHVLLLAPCRHIAVSVENRAATLYWAVTAVPRKFVDTTCLQKPKTRLARILAAAWSRRLHVVQLAPCRHIALSVTNRAATVYWAVTAVPRKSVDTTCLQTPNTRLARILSAARPRRLHVVQLAPCRHIAVIVANLAAV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.