Scaffold Ga0127644_137895

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0127644_137895

Scaffold Ga0127644_137895

Overview

Basic Information
Taxon OID	3300009463 Open in IMG/M
Scaffold ID	Ga0127644_137895 Open in IMG/M
Source Dataset Name	Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1930
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Fava Bean → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location
Location Name	Tucson, AZ, USA
Coordinates	Lat. (^o)	32.23184	Long. (^o)	-110.950699	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060091	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127644_1378952	F060091	N/A	MDKLHELNYKLDLSSESDSDEEINELLLLYSLSKRNKSIWKSAHMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYSVGCNAQKPIDPEEKLAVFLR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.