Scaffold Ga0126448_1001813

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126448_1001813

Scaffold Ga0126448_1001813

Overview

Basic Information
Taxon OID	3300009466 Open in IMG/M
Scaffold ID	Ga0126448_1001813 Open in IMG/M
Source Dataset Name	Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6153
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location
Location Name	Falmouth, Massachusetts
Coordinates	Lat. (^o)	41.548517	Long. (^o)	-70.622961	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029107	Metagenome / Metatranscriptome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126448_10018133	F029107	N/A	MTTHALTTLSNTSATRLTPNGIHSGMDITLQNVNAEAYIYIGGEDVSTTDYGYRIAPDNAWSVELPGQDALYAISDTNGAYVAMLQMGLEN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.