NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126447_1021671

Scaffold Ga0126447_1021671


Overview

Basic Information
Taxon OID3300009470 Open in IMG/M
Scaffold IDGa0126447_1021671 Open in IMG/M
Source Dataset NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1617
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location
Location NameFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)Depth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014956Metagenome / Metatranscriptome258Y
F021732Metagenome / Metatranscriptome217Y
F031483Metagenome182N

Sequences

Protein IDFamilyRBSSequence
Ga0126447_10216712F021732N/AMNITKYTCKCTLDKKLGHFVHVIFSHGFGLYGQTSPHSPEDNMEIHGWTFEPHDIDLELYPQITRYNLMPLVAENEMDWVILNNQSL*
Ga0126447_10216714F014956N/AMINIQDFALNASLTICPNHIVEPLHLKKWWRQRGVGELEKYFYTGKKIDYAQEIDWKAISDHKKQMWYDSQNFQIQAGNEYSKR*
Ga0126447_10216715F031483AGCAGMNILKGKVKYTAGKVFEGQYGPSINAVITLENGTDARVYGKADDTKLMALKKDDAVTVIHDGKSYKVAFDMVTANEIPEKVQTPTEGTNVQQAANVPPKNNGKLTHDEITEKATLMTSVYADIFHQLQASGLEPAQAQPAAATIFIQIGKYF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.