Scaffold Ga0127527_119327

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0127527_119327

Scaffold Ga0127527_119327

Overview

Basic Information
Taxon OID	3300009482 Open in IMG/M
Scaffold ID	Ga0127527_119327 Open in IMG/M
Source Dataset Name	Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6102
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (28.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Chrysanthemum → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location
Location Name	New Haven, CT, USA
Coordinates	Lat. (^o)	41.257945	Long. (^o)	-72.989398	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060091	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127527_1193273	F060091	N/A	MDEQHDLNYKLDLSSESDSDEEMNELLLLYSLSKRNKSIWKSEYMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYSVGCNAQKPIDPEEKLAVFLR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.