NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123519_10052880

Scaffold Ga0123519_10052880


Overview

Basic Information
Taxon OID3300009503 Open in IMG/M
Scaffold IDGa0123519_10052880 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4234
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (54.55%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park
CoordinatesLat. (o)44.61Long. (o)-110.44Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095753Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0123519_100528804F095753GAGMPSIKQSYAGRDFGIYFFKPSRDLHISEYLPLIEQGYERHMAKDGKHIYLLFLKVKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.