Basic Information | |
---|---|
Taxon OID | 3300009506 Open in IMG/M |
Scaffold ID | Ga0118657_11116773 Open in IMG/M |
Source Dataset Name | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Novogene |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 955 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mai Po Nature Reserve Marshes in Hong Kong | |||||||
Coordinates | Lat. (o) | 22.498889 | Long. (o) | 114.045833 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102142 | Metagenome / Metatranscriptome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118657_111167731 | F102142 | AGGAGG | MSSERAFNETAKNIFKASLVGILAVVFTVVPFEQSIAQFFGISFDEFGGGMPTVYLFPLFLIYTAMALVLAKMKKNLNVSKRGAFFIIFAFHYCIVSFLPELEGKIYLPDFPFFQTLVSGFILALAVVSLIFYLWKQEDNPEAKAGQQIKSYFSSRSVLSWVWRFLLVWLLFYILTMVISIVAYPFTKPYLDDPMNTLGMVIPSMGTLFAISQFRSLIYILVTLPFIVFWKSSKKYLFLYLALINVIQYPLLGDGLAYFWPVMYRLTDGIVLALQVTIMSWLFVTMLWKGKKT |
⦗Top⦘ |