NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115003_10003285

Scaffold Ga0115003_10003285


Overview

Basic Information
Taxon OID3300009512 Open in IMG/M
Scaffold IDGa0115003_10003285 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12855
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (18.75%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)79.2466Long. (o)-150.0613Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017048Metagenome / Metatranscriptome243Y
F031650Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0115003_100032856F031650N/AMVFFNSIVYIKYQIKMDAEMPQLTEAEFVQLKQDYANAIPEGDAIRAQLKSFNKEQKERHAKIYQYMRENNLMSADLGGITFEREEKTTVPSVSIKTLEEIVDNPAVVEQYKRDYAKTKESLKVRKPKRQRTDDASAQ*
Ga0115003_100032858F017048N/AMSEFNYQPSKSSLRADTVVEFINRSLLDFKINEIPGMGPASIQKFADHGIYTPAQIVAKFLSFVDSPDVTAQNVCEEFYNWANPIMGKANTHNLTFALANYAGEHGLFRYE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.