Scaffold Ga0114919_10000409

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114919_10000409

Scaffold Ga0114919_10000409

Overview

Basic Information
Taxon OID	3300009529 Open in IMG/M
Scaffold ID	Ga0114919_10000409 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	32841
Total Scaffold Genes	27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (37.04%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	Atlantic Ocean: Black Sea
Coordinates	Lat. (^o)	44.288	Long. (^o)	34.983	Alt. (m)		Depth (m)	2075
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033644	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114919_1000040921	F033644	N/A	VAIITQIENQESTSIDIKADELMRETKVLNIARLAKMLVDFFGIDEAFKKVGKYEGEEVELHLVELEGYITFILTSERGNFDCIAEKAKSPIARLVITVKEEKILDLISRIIRSKNSYISLIKFSRFVISGKAKIKGSYVAAIKLVRCLMIGKHEVFGSKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.