NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129283_10001491

Scaffold Ga0129283_10001491


Overview

Basic Information
Taxon OID3300009537 Open in IMG/M
Scaffold IDGa0129283_10001491 Open in IMG/M
Source Dataset NameMicrobial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12416
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location
Location NameCape Shores, Lewes, Delaware, USA
CoordinatesLat. (o)38.7855Long. (o)-75.1045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018370Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0129283_100014913F018370N/AMHKEWISRSDDPNNIKTYVAVNSKEHADKLRDYLKNDYLITLNINKIGVCYPCYQLTSGLGIKFSEAKDDDIVVFASDDFICPNGWDTYLSNKLSGVDKALFVRDGYQLPDSSNMLHPAITIPIMTYGCLKKLNMVIYHPVYNHMFSDCELYDNLKDLNLLYDDRMNDSTTFEHLHYAAGKRHADGADQAYNAKWKEDEITWNKRKLMSVEERIKFVG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.