NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115099_10061854

Scaffold Ga0115099_10061854


Overview

Basic Information
Taxon OID3300009543 Open in IMG/M
Scaffold IDGa0115099_10061854 Open in IMG/M
Source Dataset NameMarine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1197
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)36.6882Long. (o)-122.386Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001219Metagenome / Metatranscriptome744Y
F054104Metagenome / Metatranscriptome140Y
F092118Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0115099_100618542F054104N/AVKSGLLETFTTTENLITNFEKKAFLSLQRYIIFVTASRILRKFLFLSEQEQSKLIEVTIAKLGGV*
Ga0115099_100618543F092118N/AMEWHLSSFFLNNEEAFIQLNPNILESNVQNLVILIGILIYANNVSFSVSLENRQKEIIQTIENAQKDVLNASNYYYLAEKGFTQSFFGYNLGRFYMKKIKLI*
Ga0115099_100618544F001219N/ALFDFDLTFVIELALFTLLAFIVTNKFVGPISQQLDERAEFINYTLRKSTILLSFGYERLTECVELLTTEINEMNRQVKLTRNYVNTNFEEEVASVQSQNAKLLSKLKGDLSIQSAFLFSNINDELASITDKFFAKKFQSAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.