NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115103_1356325

Scaffold Ga0115103_1356325


Overview

Basic Information
Taxon OID3300009599 Open in IMG/M
Scaffold IDGa0115103_1356325 Open in IMG/M
Source Dataset NameMarine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)699
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)36.754Long. (o)-122.0208Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037230Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0115103_13563252F037230N/AMKNLTEKYVNIDWSGICSDFDLDSGDISPEQSFELDRALGNINEVIHAFIDQNKTKVHIGTATITSTEHNVLMVALDHMYEHLDDLVGDLETFEEENTNLKRIDAVNSLKKLFKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.