NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114912_1013095

Scaffold Ga0114912_1013095


Overview

Basic Information
Taxon OID3300009620 Open in IMG/M
Scaffold IDGa0114912_1013095 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2500
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.47Long. (o)11.53Alt. (m)Depth (m)3514
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016735Metagenome245Y
F042083Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0114912_10130951F042083AGGAGMARRKPAMPAPSIIGMAAGLSVAQYLNQGTSKAFGKGVIDDVLGGDLSDGFRALTDNAVDLATSPSGKAVLSSAIVLATAGGLARKWFPSVKLGGTKLYFKI*
Ga0114912_10130955F016735AGGMTDATFAAIWILSFGLYLLIYTYWIPLKTQKKIEHWLISEESNETLLASLSVITNQIREQALVDFEEFMIPQGRKAAIDFWNGAMGNAAQKLGDTEEGSQLSLLHSMTEELKDQPWYVQAAASKLIPVISKAAQNQDKKEVTKLVHGKFGFD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.