NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105173_1000569

Scaffold Ga0105173_1000569


Overview

Basic Information
Taxon OID3300009622 Open in IMG/M
Scaffold IDGa0105173_1000569 Open in IMG/M
Source Dataset NameMarine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4924
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)-24.9939Long. (o)-35.9974Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025853Metagenome / Metatranscriptome200Y
F047724Metagenome149N
F057669Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0105173_10005691F025853GAGMKKFLINYIPAVHEGQVNSDNEAYSYKVELDQQFANHSERDNSAGMAAKDTESGLWKRFRFDGIQSAVAI*
Ga0105173_10005693F057669N/AMTRITPSKHWNGFTFEFSNGWSVSMQQSDAHYCSVGKTAEVAVFDSKDNWYAYDEDSQTLEGSEADTYVNGHLDADAVAKIISIISQKKG*
Ga0105173_10005698F047724N/AVSEKNIKYYRQVFSKDDWAIGLESDDTEYLTRRFWSFWNWKATSGKLDWWTDKFAVFWTDEARFEQAVLEICRIRVMQDLGAYSLKGQKGGADVFAYDMRKEFMANLKDEVFYTQKMRTIDSSTHAELQISAENLSDWDARKA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.