NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116125_1015013

Scaffold Ga0116125_1015013


Overview

Basic Information
Taxon OID3300009628 Open in IMG/M
Scaffold IDGa0116125_1015013 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1928
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000072Metagenome / Metatranscriptome2651Y
F000540Metagenome / Metatranscriptome1043Y
F093117Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0116125_10150132F093117AGGLDSAFADFDTETAKLDLPNMQNRKPEAIKRYLEFRLQQFKMLLDAVEDYVEEKFPATGGHS*
Ga0116125_10150134F000540N/AMNKVKKKTANLPPKLTEVEQDLLSHIQDEYQLETDSLGGNPVLRRLKDNEEIRPLSANRNTIKAMEQRGLISPGKGRDPLTIVWRLKKK*
Ga0116125_10150135F000072N/AERTIDEIEQLQEMFEAPDIRPLSASDISAANRRHDEMLAHSPWFQLWQRYGVCCRTEPPVLRLGESDS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.