NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116125_1026046

Scaffold Ga0116125_1026046


Overview

Basic Information
Taxon OID3300009628 Open in IMG/M
Scaffold IDGa0116125_1026046 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1456
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000109Metagenome / Metatranscriptome2202Y
F010440Metagenome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0116125_10260461F010440AGGMTVAEAEEKIETLTRNLASSEISLSQRHKYEAQVARCHRFIQRARQKAHRSLASFAETLLGMAGDTIFDQNQNAALITAAHLIRCASIEQLAIAVPAAIRETPKNSTPPAGFKCPEFTETVECLIGMDNRTFSCECNVAIRTALQLSNIVGLQQFHQSVRRAQADSSELGPKGIVNRLTEICSAYHPKQLASTPPVRILKKRLRSAPLQSPKDPCD*
Ga0116125_10260462F000109AGGMATAKKAVTRTKRRIVAPAEERTQIRLTVDSKFTKTHFTQLFAVLKIRNKNALAEHIIMNFKTKAAQAQLVGFYNGPWLNIPFQTIDTAFVFPLTHEIADELERVGGEILGGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.