Scaffold Ga0116120_1000177

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116120_1000177

Scaffold Ga0116120_1000177

Overview

Basic Information
Taxon OID	3300009641 Open in IMG/M
Scaffold ID	Ga0116120_1000177 Open in IMG/M
Source Dataset Name	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	64471
Total Scaffold Genes	66 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	40 (60.61%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location Name	USA: Minnesota
Coordinates	Lat. (^o)	47.5028	Long. (^o)	-93.4828	Alt. (m)		Depth (m)	1.5 to 1.75
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002337	Metagenome / Metatranscriptome	569	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116120_100017720	F002337	GGAG	MNLAVILVIAAVLALGIILSLAVTRSLQARGSANMAATIRPIDVEAFRNLINPAEDDYLRRRLPPAQFRLVRRARLRAMAAYVQVAGRNATVLARVGESALASGDPRVAEAAQQLVNHALLLRRNSTVALARIYIALAYPNSGFAALRVVDRYEQLSSSAMLLGRLQNPAAAVRLFRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.