NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105854_1103265

Scaffold Ga0105854_1103265


Overview

Basic Information
Taxon OID3300009660 Open in IMG/M
Scaffold IDGa0105854_1103265 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)891
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location NameArctic
CoordinatesLat. (o)68.6137Long. (o)-149.3144Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009276Metagenome / Metatranscriptome320Y
F051278Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0105854_11032651F051278N/AMKGETPEQKWDRLQRQYQKAVQASYPNPERHGCPGTEVLRDLAARSARFEDIEDDEQWKHVIHCAPCYREYLELRESCRLGD
Ga0105854_11032652F009276N/AESQRKTIVPICIASADRHGNPIARIWFEQGVVPVQNQLRSLARYKLGDVRRVSELAEITVHKLWERHGEDAGTMPWRRVLVRAVWEARDLASGGSLWRIKHTVPLALGSLEGDLYGNGLTDPKRYDKVYEQQLLLDLVEHRIEEDHREEIREIFRMLREGYTWEEVAQRLGERTPAALKKRFWRWIRRNFPRKP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.