Scaffold Ga0116141_10324434

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116141_10324434

Scaffold Ga0116141_10324434

Overview

Basic Information
Taxon OID	3300009693 Open in IMG/M
Scaffold ID	Ga0116141_10324434 Open in IMG/M
Source Dataset Name	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	807
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	USA
Coordinates	Lat. (^o)	33.8	Long. (^o)	-118.28	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031844	Metagenome / Metatranscriptome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116141_103244341	F031844	N/A	CEPLLKLKYLNLHTGYYDTFGGWYLKQDTVNVEKQIYNRQKLGDMGTRQALPELTDEFILISYDLPIDQANYIAKSIIMSPKTFLIDTNGNEMECVVMNKNYTNALSVVNVFANINLNVKL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.