Basic Information | |
---|---|
Taxon OID | 3300009705 Open in IMG/M |
Scaffold ID | Ga0115000_10899264 Open in IMG/M |
Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 541 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean: Canada Basin | |||||||
Coordinates | Lat. (o) | 77.0991 | Long. (o) | -150.2252 | Alt. (m) | Depth (m) | 58 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046473 | Metagenome / Metatranscriptome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115000_108992641 | F046473 | N/A | HVSAGSGTTTTRSYMPGLFEALANMPKRKPKKFFITVQGKEYEVSLEKKLWSQQHGEDNLILKDGEIVVKPAPLPKSKYRILAKSEKGYFFEDDDIHWPNKIAEGGVTWQTKSE* |
⦗Top⦘ |