NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126374_10532084

Scaffold Ga0126374_10532084


Overview

Basic Information
Taxon OID3300009792 Open in IMG/M
Scaffold IDGa0126374_10532084 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_12
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)854
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098426Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0126374_105320842F098426GGAMTLTNVPPGSGLFVLLALFLTVATVWLLLRAIEALPNEINAQSFLVLIIVIVPFVMGIYFGLATIICNEIVAQPNLPLELSLRKIVPATVTYIGLSAWVWLRWRKLMLKGE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.