NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0131077_11364909

Scaffold Ga0131077_11364909


Overview

Basic Information
Taxon OID3300009873 Open in IMG/M
Scaffold IDGa0131077_11364909 Open in IMG/M
Source Dataset NameActivated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Novogene Bioinformatics Technology Co., Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)587
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan

Source Dataset Sampling Location
Location NameTai Wan
CoordinatesLat. (o)24.0Long. (o)120.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085266Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0131077_113649091F085266N/AAWARIDDEDFRGTAGAALRLAVAHTWGNPVGTEPGLTYLGPELDLSVIRVNLTLGVLFRVAGDGGSGALFSWGLGFGL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.