NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0131722_102443

Scaffold Ga0131722_102443


Overview

Basic Information
Taxon OID3300009885 Open in IMG/M
Scaffold IDGa0131722_102443 Open in IMG/M
Source Dataset NameMicrobial communities of marine sponge Cymbastella coralliophila from Great Barrier Reef, Australia - CY13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1375
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location
Location NameDavies Reef, Great Barrier Reef, Australia
CoordinatesLat. (o)-18.833Long. (o)147.683Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016734Metagenome / Metatranscriptome245Y
F036473Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0131722_1024432F016734N/AMNEDKINKLGLTDSERDAIDHEPKRSLIDLDTYQQTDVLTLQGYQLRAVMDDIVLAQYVDLSDDDRCLNRNGVLIPLSQVQRTWRLARVILAGSGCKHTKRGDIVCFPDDKGVRVDNLRVKGYEDPLRHCLFLNEQRFFGICEEL*
Ga0131722_1024433F036473N/AVIVSLIHLKGELLQKVCEVRFMRRRTKRGSSILRRMLCTNNEQLLNSIEGRTALNYRPTRGLLKYNPNQKNLLVTWDIMMQDYRQINCDAVDLITTLDADDTFWSYLSEHIAPMSAQDKINFHNT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.