NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117933_1012837

Scaffold Ga0117933_1012837


Overview

Basic Information
Taxon OID3300009943 Open in IMG/M
Scaffold IDGa0117933_1012837 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0139325, Gp0139347, Gp0139348
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3190
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → MCG-1 → miscellaneous Crenarchaeota group-1 archaeon SG8-32-3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment → Stable Isotope Probing Incubations Of Microbial Communities From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameChocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.71538Long. (o)-110.73627Alt. (m)Depth (m).01 to .02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021459Metagenome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0117933_10128371F021459GAGMSQDDIVKRALEEFHLRVSESANAEHVPPAKVLPNGNNVITLKCIQGSASYEVEVELTKRGKFVDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.