Scaffold Ga0117933_1175328

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117933_1175328

Scaffold Ga0117933_1175328

Overview

Basic Information
Taxon OID	3300009943 Open in IMG/M
Scaffold ID	Ga0117933_1175328 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0139325, Gp0139347, Gp0139348
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2184
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment → Stable Isotope Probing Incubations Of Microbial Communities From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.71538	Long. (^o)	-110.73627	Alt. (m)		Depth (m)	.01 to .02
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033261	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117933_11753282	F033261	N/A	EFAHRIGKHDLDLDILPPGYVLSTHRDEHSQLVREVEYDDTAFFLSGWLRCLVFNLLTCFAQALGGQYTTMWAGTLLRKFMRRPATLYLVGKELHIVFDPFPGQGELQPLLERLNAQRTALPWLNNLWPAWATLARMGHLVVQFRIAQDEPLHPLAEPEKRKRLFGDVQPPEGP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.