Basic Information | |
---|---|
Taxon OID | 3300009946 Open in IMG/M |
Scaffold ID | Ga0131844_103998 Open in IMG/M |
Source Dataset Name | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 03 mira |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Center for Advanced Technologies in Genomics, Sao Paulo University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2660 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sao Paulo Zoo, Brazil | |||||||
Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078430 | Metagenome | 116 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0131844_1039982 | F078430 | N/A | MEGAALMATMLGGVVLPRVYVQESEPDWAGKPIRRWTLRTRPLTWEQYAAIEQMVREVGVARFIERAVDGTPHVLGASQVALILDEGGGRTTTAMVYITAYRVVRPLSLPQRREIELQL |
⦗Top⦘ |