Scaffold Ga0133741_101043

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133741_101043

Scaffold Ga0133741_101043

Overview

Basic Information
Taxon OID	3300009965 Open in IMG/M
Scaffold ID	Ga0133741_101043 Open in IMG/M
Source Dataset Name	Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 7
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Autonomous University of Barcelona
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1854
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain

Source Dataset Sampling Location
Location Name	Alicante,Spain
Coordinates	Lat. (^o)	38.3852246	Long. (^o)	-0.5132249	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095632	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0133741_1010435	F095632	N/A	MTMSFKETTGYKVVSLVASTSASITAGAVVGALCPPAGVVLTAIYGVGSSVLGTYVGDKAGRQYAETLAETIDSLQTPQNN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.