Basic Information | |
---|---|
Taxon OID | 3300009966 Open in IMG/M |
Scaffold ID | Ga0133736_1090033 Open in IMG/M |
Source Dataset Name | Termite gut microbial communities. Combined Assembly of Gp0151149, Gp0151152, Gp0151222, Gp0151223 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Luxembourg, Luxembourg Institute of Science and Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2211 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | France | |||||||
Coordinates | Lat. (o) | 48.913957 | Long. (o) | 2.485499 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008188 | Metagenome | 337 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133736_10900332 | F008188 | N/A | MRRRTVFFMAVSALHVWGGFSAHHQELKNCTHIIWYMSSLLAATASGSSKQVFELLMMGGEAT |
⦗Top⦘ |