Scaffold Ga0133736_1132611

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133736_1132611

Scaffold Ga0133736_1132611

Overview

Basic Information
Taxon OID	3300009966 Open in IMG/M
Scaffold ID	Ga0133736_1132611 Open in IMG/M
Source Dataset Name	Termite gut microbial communities. Combined Assembly of Gp0151149, Gp0151152, Gp0151222, Gp0151223
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Luxembourg, Luxembourg Institute of Science and Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2807
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Timematodea → Timematoidea → Timematidae → Timema → Timema poppensis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location
Location Name	France
Coordinates	Lat. (^o)	48.913957	Long. (^o)	2.485499	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015292	Metagenome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133736_11326113	F015292	N/A	HCILGKFLGVGCHCFPPPLDVPTFSARCLHVQRRERTLAAEGGTLRGREMFRLIPSTIRLPRNCRDLLHAANLRHGTDGFTSPPKEGVLRIFSPLKIRRPRPGLNPRTWVPKASTLPLDHQSRLYIYVDMMFATGVPSY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.